PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g035552m
Common NameCISIN_1g035552mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family B3
Protein Properties Length: 70aa    MW: 8111.2 Da    PI: 4.9692
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g035552mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B332.81.2e-1013653286
                       --SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                 B3 32 esktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86
                        s   +l+ ++g  W+v +  rk  g+++l +GW+eF + + +++g +vvF++++
  orange1.1g035552m 13 LSSVARLTVPNGYIWRVDI--RKDEGKVWLDDGWQEFMEYHLICVGFSVVFQYEK 65
                       445789999**********..*******************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.588169IPR003340B3 DNA binding domain
SuperFamilySSF1019364.9E-10765IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.7E-10868IPR015300DNA-binding pseudobarrel domain
PfamPF023621.5E-71365IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
YSATVRAKFG DELSSVARLT VPNGYIWRVD IRKDEGKVWL DDGWQEFMEY HLICVGFSVV  60
FQYEKISNF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006494701.14e-21PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLA0A067D9358e-46A0A067D935_CITSI; Uncharacterized protein (Fragment)
STRINGPOPTR_0010s19890.14e-15(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15912578
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-18B3 family protein